Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Protein jagunal homolog 1(jagn1)

Recombinant Xenopus tropicalis Protein jagunal homolog 1(jagn1)

SKU:CSB-CF740668XBF

Regular price $2,139.20 CAD
Regular price Sale price $2,139.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6NVQ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASRAGPRATGTDGSDFQHRERVASHYQMSASLKNEIKKLIYAHLVIWLLIAAQMCVSHL KLVSKDLVAMPYQWEYPYLLSLVPSLFGLVSFPRNNISYLVISMISTGLFSIAPLIYGTL EMFPMAQQLYRHGKAYRFIFGFSAISVMYLLMVVAVQVHGWQIYYSKKLLDAWFTNTQEK KKK

Protein Names:Recommended name: Protein jagunal homolog 1

Gene Names:Name:jagn1 ORF Names:TNeu044c16.1

Expression Region:1-183

Sequence Info:full length protein

View full details