Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Probable N-acetyltransferase camello(cml)

Recombinant Xenopus tropicalis Probable N-acetyltransferase camello(cml)

SKU:CSB-CF717967XBF

Regular price $2,192.40 CAD
Regular price Sale price $2,192.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q66KL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANVSIRKYKTSDYETARFLFAEGTKEHLPAACMYTLTTPRFYFITFVAFTSVFMGTGSY VLALTSLVALLAAGWYGLYSEFHGLASRFLRKDMLDIEKSYMMSENACFWVAEIDGKVVG TVGAQPSTDADDELLLQRISVARDYRQLRIGTKLCQTVIDFARQRGFNAVCLETANIQRA ATNLYERVGFKKSRVEILPSLVHQYTSFTVAYYRYNIKS

Protein Names:Recommended name: Probable N-acetyltransferase camello EC= 2.3.1.-

Gene Names:Name:cml

Expression Region:1-219

Sequence Info:full length protein

View full details