Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y(pigy)

Recombinant Xenopus tropicalis Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y(pigy)

SKU:CSB-CF017988XBF

Regular price $1,974.00 CAD
Regular price Sale price $1,974.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:P0C1P1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PVILWDPSLLPTDNKTQSSIKLKWGTYQEMLRHKCWLNGKAPKADLGCTEIHHQEWCKMA

Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y Alternative name(s): Phosphatidylinositol-glycan biosynthesis class Y protein Short name= PIG-Y

Gene Names:Name:pigy

Expression Region:1-71

Sequence Info:full length protein

View full details