Recombinant Xenopus tropicalis Myelin protein P0(mpz)

SKU: CSB-CF014774XBF

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:A0JM41

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IEVYTDREVYGTVGSRVTLSCSFWSSEWISDDVSVTWHYQPDHSREMYSIFHYAKGQPSIDAGVFKDRIEWVGSPKWKDASIVLHNLELIDNGTFTCDVKNPPDVVGKSSYVHLQVQEKGAARAGLVLGIIIAVALALVIVVTILILLIRYCWLRRQVRVQRELSALERGKLHKAKDSSKRSSRQTPILYAMLDQTRGKASEKKGKGGIGDSRKDRK

Protein Names:Recommended name: Myelin protein P0 Alternative name(s): Myelin peripheral protein Short name= MPP Myelin protein zero

Gene Names:Name:mpz

Expression Region:27-243

Sequence Info:full length protein