Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)

Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)

SKU:CSB-EP023446XBE

Regular price $1,332.50 CAD
Regular price Sale price $1,332.50 CAD
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P16176

Gene Names: tgfb1

Organism: Xenopus laevis (African clawed frog)

AA Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

Expression Region: 271-382aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 28.6 kDa

Alternative Name(s): Short name: TGF-beta-1 Alternative name(s): TGF-beta-5

Relevance: Important role in certain aspects of differentiation.

Reference: "Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)