Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis TM2 domain-containing protein 3(tm2d3)

Recombinant Xenopus laevis TM2 domain-containing protein 3(tm2d3)

SKU:CSB-CF728508XBE

Regular price $2,189.60 CAD
Regular price Sale price $2,189.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6DE06

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FEYSQPVAQPLKDTFPSSTTATSIKATTTKMPEYMEICPSNGQCSRLASDCMTCATNYSC IYGKLVTFNCTAKNGVVCFDENSQRQEYFTISMACQFCWQLPPSDYVCNLSSSCKTISCP RQRYNTTCTVLDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR EGLGKLFSFGGLGIWTLIDVFLISVGYVGPADGSLYI

Protein Names:Recommended name: TM2 domain-containing protein 3

Gene Names:Name:tm2d3

Expression Region:31-247

Sequence Info:full length protein

View full details