Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Mitochondrial cardiolipin hydrolase(pld6)

Recombinant Xenopus laevis Mitochondrial cardiolipin hydrolase(pld6)

SKU:CSB-CF018149XBE

Regular price $2,179.80 CAD
Regular price Sale price $2,179.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:A1L1C2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLWGRWKLAAGLAGLALSLELFYRYMRRRKPLREVLFFPVPVTCIEPVLSPMKQCSCPLPHTDSAFSRLLVQLLGAQRSLELCVFTFSSPSLARALLILHRRDVRVRVITDNDYMAAPGSQIGPLRSAGVAVRHDQSSGYMHHKFAVVDGTVVLTGSLNWTVQAFQSNKENILITDDTVIVKAYQKEFERLWEEYDPATYNFFPEKENK

Protein Names:Recommended name: Mitochondrial cardiolipin hydrolase EC= 3.1.4.- Alternative name(s): Choline phosphatase 6 Mitochondrial phospholipase Short name= MitoPLD Phosphatidylcholine-hydrolyzing phospholipase D6 Phospholipase D6 Short name= PLD 6

Gene Names:Name:pld6

Expression Region:1-210

Sequence Info:full length protein

View full details