Gene Bio Systems
Recombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein xcc-b100_1273 (xcc-b100_1273)
Recombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein xcc-b100_1273 (xcc-b100_1273)
SKU:CSB-CF536045XAZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xanthomonas campestris pv. campestris (strain B100)
Uniprot NO.:B0RQ88
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPAASG RVYAAYGGVYIATALLWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG
Protein Names:Recommended name: UPF0060 membrane protein xcc-b100_1273
Gene Names:Ordered Locus Names:xcc-b100_1273
Expression Region:1-111
Sequence Info:full length protein
