Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein XCC4075(XCC4075)

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein XCC4075(XCC4075)

SKU:CSB-CF840054XAY

Regular price $2,154.60 CAD
Regular price Sale price $2,154.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)

Uniprot NO.:Q8P3J6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPLSIVLLGFAMSTDAFAAAIGKGAAMRRPRWRDAVRAGLVFGCIEAITPVIGWMLGRA ASDYLAAFDHWIAFGLLGALGAHMIVAGLRNESEVDEALRDTPKRYGLLALAATGFATSI DAMAVGVSLAFLDVHIGVVAAVVGLCTLSMVTAGVMLGRALGALIGKRAEILGGVILILI GSTILYEHLSGAA

Protein Names:Recommended name: UPF0059 membrane protein XCC4075

Gene Names:Ordered Locus Names:XCC4075

Expression Region:1-193

Sequence Info:full length protein

View full details