Recombinant White-rot fungus Cellobiose dehydrogenase(CDH-1),partial

SKU: CSB-YP312474EUK

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Microbiology

Uniprot ID: Q01738

Gene Names: CDH-1

Organism: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

AA Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Expression Region: 19-208aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 22.3 kDa

Alternative Name(s): Cellobiose-quinone oxidoreductase

Relevance: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.

Reference: "Cellobiose dehydrogenase from Phanerochaete chrysosporium is encoded by two allelic variants."Li B., Nagalla S.R., Renganathan V.Appl. Environ. Microbiol. 63:796-799(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.