Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_11s0052g01140 (VIT_11s0052g01140)

Recombinant Vitis vinifera CASP-like protein VIT_11s0052g01140 (VIT_11s0052g01140)

SKU:CSB-CF417266VFQ

Regular price $2,172.80 CAD
Regular price Sale price $2,172.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7Q6G6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVLGVGPRTVTPHLRKGMMESSSGISLARAEAFLRLFAILVLVLTACLLGFDTQTKLLF STIKKTATFRDLGALQVVVYVDSVAAGYNLLQLGRGFISAKLKGKLINVSYVTLPWVCFL LDQAAVYTVFSANTAALQASIIAVTGESSLQWMKVCNRYTRFCIQVGGALLSGYLASLLM VLLSSLSAFSLFRLYSPKQFHLLKPT

Protein Names:Recommended name: CASP-like protein VIT_11s0052g01140

Gene Names:Ordered Locus Names:VIT_11s0052g01140 ORF Names:GSVIVT00031388001, GSVIVT01029179001, VIT_00029179001, Vv11s0052g01140

Expression Region:1-206

Sequence Info:full length protein

View full details