Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_05s0020g01820 (VIT_05s0020g01820)

Recombinant Vitis vinifera CASP-like protein VIT_05s0020g01820 (VIT_05s0020g01820)

SKU:CSB-CF415854VFQ

Regular price $2,157.40 CAD
Regular price Sale price $2,157.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7NW78

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVESKTSFGGMESKSKEVKVVTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSL QLLPTLPPMDVPVTAKWRYLSAFVYFVVSNAIACSYAALSLLLSVGNSKGNKGLGLAITV MDLVMVALLFSSNGAAGAIGLMGYEGNSRVRWGKVCNVFGKFCNQVAVALGLSFFGGLAF FLLVVMAAFALNKRH

Protein Names:Recommended name: CASP-like protein VIT_05s0020g01820

Gene Names:Ordered Locus Names:VIT_05s0020g01820 ORF Names:GSVIVT00019813001, GSVIVT01017795001, VIT_00017795001, Vv05s0020g01820

Expression Region:1-195

Sequence Info:full length protein

View full details