Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vicia faba Legumin type B(LEB6),partial

Recombinant Vicia faba Legumin type B(LEB6),partial

SKU:CSB-YP323408VFJ

Regular price $1,462.50 CAD
Regular price Sale price $1,462.50 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: LEB6

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Vicia faba (Broad bean) (Faba vulgaris)

Delivery time: 3-7 business days

Uniprot ID: P16079

AA Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-148aa

Protein length: Partial

MW: 19.0 kDa

Alternative Name(s): Legumin type B acidic chain

Relevance: This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals.

Reference: "The legumin gene family: structure and evolutionary implications of Vicia faba B-type genes and pseudogenes." Heim U., Schubert R., Baeumlein H., Wobus U. Plant Mol. Biol. 13:653-663(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details