Gene Bio Systems
Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC_1233(VC_1233)
Recombinant Vibrio cholerae serotype O1 UPF0299 membrane protein VC_1233(VC_1233)
SKU:CSB-CF881619VEX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Uniprot NO.:Q9KSM3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVE WVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRM LKKGKKSCG
Protein Names:Recommended name: UPF0299 membrane protein VC_1233
Gene Names:Ordered Locus Names:VC_1233
Expression Region:1-129
Sequence Info:full length protein
