Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio cholerae serotype O1 UPF0208 membrane protein VC_1099(VC_1099)

Recombinant Vibrio cholerae serotype O1 UPF0208 membrane protein VC_1099(VC_1099)

SKU:CSB-CF885226VEX

Regular price $2,090.20 CAD
Regular price Sale price $2,090.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Uniprot NO.:Q9KT06

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MNNKVGIVHSLKDGQKYMDIWPMRKELNPLFPEQRVIKATRFAIKVMPAVAAISVLTQMV FANTQAMPQAIVVALFAMSLPLQGIWWLGHRANTQLPPALASWYRELYMKIVETGFALEP IKSKPRYKELAQVLNRAFRQLDDTALERWF

Protein Names:Recommended name: UPF0208 membrane protein VC_1099

Gene Names:Ordered Locus Names:VC_1099

Expression Region:1-150

Sequence Info:full length protein

View full details