Gene Bio Systems
Recombinant Vibrio cholerae serotype O1 UPF0208 membrane protein VC_1099(VC_1099)
Recombinant Vibrio cholerae serotype O1 UPF0208 membrane protein VC_1099(VC_1099)
SKU:CSB-CF885226VEX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Uniprot NO.:Q9KT06
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MNNKVGIVHSLKDGQKYMDIWPMRKELNPLFPEQRVIKATRFAIKVMPAVAAISVLTQMV FANTQAMPQAIVVALFAMSLPLQGIWWLGHRANTQLPPALASWYRELYMKIVETGFALEP IKSKPRYKELAQVLNRAFRQLDDTALERWF
Protein Names:Recommended name: UPF0208 membrane protein VC_1099
Gene Names:Ordered Locus Names:VC_1099
Expression Region:1-150
Sequence Info:full length protein
