Recombinant Vibrio cholerae serotype O1  Universal stress protein B homolog(uspB)

Recombinant Vibrio cholerae serotype O1 Universal stress protein B homolog(uspB)

CSB-CF398381VEY
Regular price
$1,448.00 CAD
Sale price
$1,448.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)

Uniprot NO.:A5F4E9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISGDTILFALMLVTAINVARYVTALRSLIYIMREAHPLLYQQVDGRGFFTTHGNVTKQV RLYHYLKSREYHHHHDPVFTGKCDRVRELFILSGSLLVLTTVVAFML

Protein Names:Recommended name: Universal stress protein B homolog

Gene Names:Name:uspB Ordered Locus Names:VC0395_A2436, VC395_0101

Expression Region:1-107

Sequence Info:full length protein

Your list is ready to share