Gene Bio Systems
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC)
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC)
SKU:CSB-CF399953VEY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)
Uniprot NO.:A5F4Z1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNRKPYVREMKRTWWKDHPFYRFYMVREATVLPLILFTLFLTVGLGSLVKGPEAWQTWL DFMANPLVIAINLVALAGSLFHAQTFFSMMPQVVPIRLGGKLVDKKIIVLAQWAAVAFIS LIVLIVV
Protein Names:Recommended name: Fumarate reductase subunit C
Gene Names:Name:frdC Ordered Locus Names:VC0395_A2232, VC395_2771
Expression Region:1-127
Sequence Info:full length protein
