Skip to product information
1 of 1

Gene Bio Systems

Recombinant Verminephrobacter eiseniae UPF0060 membrane protein Veis_0342 (Veis_0342)

Recombinant Verminephrobacter eiseniae UPF0060 membrane protein Veis_0342 (Veis_0342)

SKU:CSB-CF379529VDX

Regular price $2,031.40 CAD
Regular price Sale price $2,031.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Verminephrobacter eiseniae (strain EF01-2)

Uniprot NO.:A1WES5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELLKATVLFTITAVVEIVGCYLPWLVIKQNKPLWLLLPAALSLALFAWLLTLHPSAAGR TYAAYGGIYIAVALAWLHWVDGVSLTRWDVAGATVAMVGMLIIMLQPASA

Protein Names:Recommended name: UPF0060 membrane protein Veis_0342

Gene Names:Ordered Locus Names:Veis_0342

Expression Region:1-110

Sequence Info:full length protein

View full details