Skip to product information
1 of 1

Gene Bio Systems

Recombinant Variovorax paradoxus Probable intracellular septation protein A (Vapar_2937)

Recombinant Variovorax paradoxus Probable intracellular septation protein A (Vapar_2937)

SKU:CSB-CF511709VEM

Regular price $2,133.60 CAD
Regular price Sale price $2,133.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Variovorax paradoxus (strain S110)

Uniprot NO.:C5CNT0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLILDFFPILLFFGAYKLADIYTATGVLMAATVLQMGIIYAMERKLQAMQKATLVLILL FGTLTLVLHDDRFIKWKPTVLYGAMAIALAVALWALKKNFLKMLLGSQLQLPDRIWGRLN VAWIGYCLFMAAINGYVAAYFTTEAWVNFKLWGYVFPIVFLVAQGLYISPHLKNDEPSV

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Vapar_2937

Expression Region:1-179

Sequence Info:full length protein

View full details