Gene Bio Systems
Recombinant Variola virus Protein L2 (L2R, M2R)
Recombinant Variola virus Protein L2 (L2R, M2R)
SKU:CSB-CF333764VAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Uniprot NO.:P33041
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEVIADRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQMLLALLALVISLTIFYYFIL
Protein Names:Recommended name: Protein L2
Gene Names:ORF Names:L2R, M2R
Expression Region:1-87
Sequence Info:full length protein
