Gene Bio Systems
Recombinant Variola virus Protein A34 (A34R, A37R)
Recombinant Variola virus Protein A34 (A34R, A37R)
SKU:CSB-CF341461VAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Uniprot NO.:P33851
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSLNRQTVSRFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNTVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNNKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKRFYK
Protein Names:Recommended name: Protein A34
Gene Names:ORF Names:A34R, A37R
Expression Region:1-168
Sequence Info:full length protein
