Skip to product information
1 of 1

Gene Bio Systems

Recombinant Variola virus Protein A34 (A34R, A37R)

Recombinant Variola virus Protein A34 (A34R, A37R)

SKU:CSB-CF341461VAR

Regular price $2,116.80 CAD
Regular price Sale price $2,116.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Uniprot NO.:P33851

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSLNRQTVSRFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNTVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNNKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKRFYK

Protein Names:Recommended name: Protein A34

Gene Names:ORF Names:A34R, A37R

Expression Region:1-168

Sequence Info:full length protein

View full details