Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Uniprot NO.:P0C764
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EPNFAERNFWHASCSARGVYIDGSMITTLFFYASLLGVCVALISLAYHACFRLFTRSVLR STW
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:GN ORF Names:9A
Expression Region:25-87
Sequence Info:full length protein