Gene Bio Systems
Recombinant Varicella-zoster virus Envelope protein US9(ORF65)
Recombinant Varicella-zoster virus Envelope protein US9(ORF65)
SKU:CSB-CF745113VAQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Uniprot NO.:Q77NN6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGQNTMEGEAVALLMEAVVTPRAQPNNTTITAIQPSRSAEKCYYSDSENETADEFLRRI GKYQHKIYHRKKFCYITLIIVFVFAMTGAAFALGYITSQFVG
Protein Names:Recommended name: Envelope protein US9 Alternative name(s): Envelope protein 65 ORF65 protein
Gene Names:ORF Names:ORF65
Expression Region:1-102
Sequence Info:full length protein
