Gene Bio Systems
Recombinant Vanderwaltozyma polyspora Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
Recombinant Vanderwaltozyma polyspora Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
SKU:CSB-CF418593VDW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Uniprot NO.:A7TQM5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALEPSRYLDKKTWKMTPAMIRARQPYFKKNMIALGLLLGITTGVYVYTFNLSHKDNDFI DVPIPPIDEKELAVLQKEFNDKKN
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 ORF Names:Kpol_1027p21
Expression Region:1-84
Sequence Info:full length protein
