Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Uniprot NO.:A7TMN2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKIWKFTSFATISSVAAASLYLYAIDKNGYYYEKSKFKQVTDRVRKLIDGDETFKYVTI DDFVSGPTQIQTRSRGETFKDLWNAEVRRTAQWIYSLGGR
Protein Names:Recommended name: Altered inheritance of mitochondria protein 5, mitochondrial Alternative name(s): Found in mitochondrial proteome protein 51
Gene Names:Name:AIM5 Synonyms:FMP51 ORF Names:Kpol_1066p10
Expression Region:1-100
Sequence Info:full length protein