Gene Bio Systems
Recombinant Vacuolar protein sorting-associated protein 55 homolog(C30B5.2)
Recombinant Vacuolar protein sorting-associated protein 55 homolog(C30B5.2)
SKU:CSB-CF618228CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q18319
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGGVRAVAALAFAGVVGLTFLVLGCALPRYGTWTPMFVITFYVLSPVPLLIARRFQEDMT GTNACIELALFITTGIVISAFALPIVLAHAGTIANSACFLVNTGSVIMFGTIIAYFYLHR DDDSGSWSQSLF
Protein Names:Recommended name: Vacuolar protein sorting-associated protein 55 homolog
Gene Names:ORF Names:C30B5.2
Expression Region:1-132
Sequence Info:full length protein
