Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Ankara) (VACV)
Uniprot NO.:O57222
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDNKKNTNNDKR NESSINSNSSPK
Protein Names:Recommended name: Virion membrane protein A9
Gene Names:Ordered Locus Names:MVA120L, ACAM3000_MVA_120 ORF Names:A9L
Expression Region:23-94
Sequence Info:full length protein