Recombinant Vaccinia virus Protein L3(VACWR090)

SKU: CSB-YP362179VAI

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P07614

Gene Names: VACWR090

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV

Expression Region: 1-350aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 42.6 kDa

Alternative Name(s): Protein F4

Relevance: Might be required for transcription of early genes.

Reference: "Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome."Plucienniczak A., Schroeder E., Zettlmeissl G., Streeck R.E.Nucleic Acids Res. 13:985-998(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.