Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Protein L2 (VACWR089)

Recombinant Vaccinia virus Protein L2 (VACWR089)

SKU:CSB-CF357159VAI

Regular price $1,783.75 CAD
Regular price Sale price $1,783.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:P07613

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVITDRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQMLLALVALVITLTIFYYFIL

Protein Names:Recommended name: Protein L2 Alternative name(s): Protein F3

Gene Names:Ordered Locus Names:VACWR089 ORF Names:L2R

Expression Region:1-87

Sequence Info:full length protein

View full details