Gene Bio Systems
Recombinant Vaccinia virus Protein I2 (I2L)
Recombinant Vaccinia virus Protein I2 (I2L)
SKU:CSB-CF303743VAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Copenhagen) (VACV)
Uniprot NO.:P68604
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW
Protein Names:Recommended name: Protein I2
Gene Names:ORF Names:I2L
Expression Region:1-73
Sequence Info:full length protein
