Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Others
Uniprot ID: P24083
Gene Names: PS/HR
Organism: Vaccinia virus (strain Lister) (VACV)
AA Sequence: VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Expression Region: 18-279aa
Sequence Info: Extracellular Domain
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-tagged
MW: 33.2 kDa
Alternative Name(s): Protein B5
Relevance: Regulation of plaque size and host range.
Reference: "Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins."Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M.Virology 181:158-164(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.