Gene Bio Systems
Recombinant Vaccinia virus Late protein H7(TH8R)
Recombinant Vaccinia virus Late protein H7(TH8R)
SKU:CSB-CF872817VAH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Tian Tan) (VACV)
Uniprot NO.:Q9JFA9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEMDKRMKSLAMTAFFGELNTLDIMALIMSIFKRHPNNTIFSVDKDGQFIIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Protein Names:Recommended name: Late protein H7
Gene Names:ORF Names:TH8R
Expression Region:1-146
Sequence Info:full length protein
