Skip to product information
1 of 1

GeneBio Systems

Recombinant Vaccinia virus Envelope protein H3 (OPG108) (X27S,X28S,X29S), partial, Biotinylated

Recombinant Vaccinia virus Envelope protein H3 (OPG108) (X27S,X28S,X29S), partial, Biotinylated

SKU:P30895

Regular price $1,485.80 CAD
Regular price Sale price $1,485.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P30895

Gene Names: OPG108

Alternative Name(s): Ag35;Virion envelope protein p35;Fragments

Abbreviation: Recombinant Vaccinia virus OPG108 protein (X27S,X28S,X29S), partial, Biotinylated

Organism: Vaccinia virus (strain L-IVP) (VACV)

Source: E.coli

Expression Region: 1-56aa(X27S,X28S,X29S)

Protein Length: Partial

Tag Info: N-terminal MBP-taggedand C-terminal 6xHis-Avi-tagged

Target Protein Sequence: PEKRNVVVVKDDPDHYKDYAHDKKIDSSSRFIITGNKVKTEKINRQILDNAAKYVE

MW: 54.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Envelope protein that binds to heparan sulfate on the cell surface and might provide virion attachment to target cell.

Reference:

Function:

View full details