Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ustilago maydis Protein YOP1(YOP1)

Recombinant Ustilago maydis Protein YOP1(YOP1)

SKU:CSB-CF705980UBS

Regular price $2,123.80 CAD
Regular price Sale price $2,123.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Uniprot NO.:Q4P0H0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAQAQQIQQKVEYFVAQIDKELSRYPALKKFEQTVPVPKAYAALGAFGIFTLFVFFNIA AGFLTNLLGFFVPAYFSLKALESPQPQDDIQWLTYWVVFGLFTFLETFINIVLYYIPWYY TIKTLAIVWLMLPQTQGAKMVYSRIIRPVFLTTQKTVHQANASTPAAPAETH

Protein Names:Recommended name: Protein YOP1

Gene Names:Name:YOP1 ORF Names:UM06393

Expression Region:1-172

Sequence Info:full length protein

View full details