Gene Bio Systems
Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40(MIA40)
Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40(MIA40)
SKU:CSB-CF700030UBS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)
Uniprot NO.:Q4P8D2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VATKAAAGPSRQSALSSYSIAAVTAIGVGASFYALQSRSSAIQCEPRQAWHDRLKPKEAK GDATLHKDAHTRHAPAEVQDERVEPVEETPVAIEVAVEESEEQTGQQSAYDPETGEINWD CPCLGGMAHGPCGEQFKLAFSCFVYSEAEPKGIDCVDKFKAMQDCFREHPDVYKDEIEDD EAANAQFEKEEANAKSNGLNDAAQEAVEESSGGKEGASA
Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40
Gene Names:Name:MIA40 Synonyms:TIM40 ORF Names:UM03631
Expression Region:29-247
Sequence Info:full length protein
