Gene Bio Systems
Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042(UU042)
Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042(UU042)
SKU:CSB-CF882461UAO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ureaplasma parvum serovar 3 (strain ATCC 700970)
Uniprot NO.:Q9PRA3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSPISIELIIQISIGLSASLILLFAFLPQTLLTIKTKNTAALTISMFIICFIARLCFSLS AILTIIVYIHNQNYGLSLYALTLPVLICHGINMLLNLIIAFIKINNVYKAKIHKMNENEY IIFAYAQKLKEKVSIKNK
Protein Names:Recommended name: Uncharacterized protein UU042
Gene Names:Ordered Locus Names:UU042
Expression Region:1-138
Sequence Info:full length protein
