Gene Bio Systems
Recombinant UPF0442 protein YPO0485-y3689-YP_3694(YPO0485, y3689, YP_3694)
Recombinant UPF0442 protein YPO0485-y3689-YP_3694(YPO0485, y3689, YP_3694)
SKU:CSB-CF748315YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q74Q23
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Protein Names:Recommended name: UPF0442 protein YPO0485/y3689/YP_3694
Gene Names:Ordered Locus Names:YPO0485, y3689, YP_3694
Expression Region:1-153
Sequence Info:full length protein
