Gene Bio Systems
Recombinant UPF0410 protein yeaQ(yeaQ)
Recombinant UPF0410 protein yeaQ(yeaQ)
SKU:CSB-CF354903EGX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O6
Uniprot NO.:P64486
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF GSFVVAVIGAIVVLFIYRKIKS
Protein Names:Recommended name: UPF0410 protein yeaQ
Gene Names:Name:yeaQ Ordered Locus Names:c2200
Expression Region:1-82
Sequence Info:full length protein
