Gene Bio Systems
Recombinant UPF0266 membrane protein YPO1755-y2554-YP_1637(YPO1755, y2554, YP_1637)
Recombinant UPF0266 membrane protein YPO1755-y2554-YP_1637(YPO1755, y2554, YP_1637)
SKU:CSB-CF852511YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8ZFF7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS
Protein Names:Recommended name: UPF0266 membrane protein YPO1755/y2554/YP_1637
Gene Names:Ordered Locus Names:YPO1755, y2554, YP_1637
Expression Region:1-153
Sequence Info:full length protein
