Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0233 membrane protein Rv0011c-MT0014 (Rv0011c, MT0014)

Recombinant UPF0233 membrane protein Rv0011c-MT0014 (Rv0011c, MT0014)

SKU:CSB-CF300024MVZ

Regular price $2,006.20 CAD
Regular price Sale price $2,006.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P67376

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQA PTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Protein Names:Recommended name: UPF0233 membrane protein Rv0011c/MT0014

Gene Names:Ordered Locus Names:Rv0011c, MT0014 ORF Names:MTCY10H4.11c

Expression Region:1-93

Sequence Info:full length protein

View full details