Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0208 membrane protein YPO2564-y1623-YP_2375(YPO2564, y1623, YP_2375)

Recombinant UPF0208 membrane protein YPO2564-y1623-YP_2375(YPO2564, y1623, YP_2375)

SKU:CSB-CF835288YAS

Regular price $2,091.60 CAD
Regular price Sale price $2,091.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:Q8ZDJ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL

Protein Names:Recommended name: UPF0208 membrane protein YPO2564/y1623/YP_2375

Gene Names:Ordered Locus Names:YPO2564, y1623, YP_2375

Expression Region:1-151

Sequence Info:full length protein

View full details