Gene Bio Systems
Recombinant UPF0060 membrane protein Rv2639c-MT2717 (Rv2639c, MT2717)
Recombinant UPF0060 membrane protein Rv2639c-MT2717 (Rv2639c, MT2717)
SKU:CSB-CF355478MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P67146
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Protein Names:Recommended name: UPF0060 membrane protein Rv2639c/MT2717
Gene Names:Ordered Locus Names:Rv2639c, MT2717 ORF Names:MTCY441.09c
Expression Region:1-110
Sequence Info:full length protein
