Gene Bio Systems
Recombinant Uncharacterized protein yqjD(yqjD)
Recombinant Uncharacterized protein yqjD(yqjD)
SKU:CSB-CF353139SZB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P64584
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR
Protein Names:Recommended name: Uncharacterized protein yqjD
Gene Names:Name:yqjD Ordered Locus Names:SF3141, S3349
Expression Region:1-101
Sequence Info:full length protein
