Gene Bio Systems
Recombinant Uncharacterized protein Rv2876-MT2944.1(Rv2876, MT2944.1)
Recombinant Uncharacterized protein Rv2876-MT2944.1(Rv2876, MT2944.1)
SKU:CSB-CF608841MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:Q10802
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFGQWEFDVSPTGGIAVASTEVEHFAGSQHEVDTAEVPSAAWGWSRIDHRTWHIVGLCIF GFLLAMLRGNHVGHVEDWFLITFAAVVLFVLARDLWGRRRGWIR
Protein Names:Recommended name: Uncharacterized protein Rv2876/MT2944.1
Gene Names:Ordered Locus Names:Rv2876, MT2944.1 ORF Names:MTCY274.07
Expression Region:1-104
Sequence Info:full length protein
