Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv2203-MT2259 (Rv2203, MT2259)

Recombinant Uncharacterized protein Rv2203-MT2259 (Rv2203, MT2259)

SKU:CSB-CF354428MVZ

Regular price $2,209.20 CAD
Regular price Sale price $2,209.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64949

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY

Protein Names:Recommended name: Uncharacterized protein Rv2203/MT2259

Gene Names:Ordered Locus Names:Rv2203, MT2259 ORF Names:MTCY190.14

Expression Region:1-230

Sequence Info:full length protein

View full details