Gene Bio Systems
Recombinant Uncharacterized protein Rv1417-MT1460 (Rv1417, MT1460)
Recombinant Uncharacterized protein Rv1417-MT1460 (Rv1417, MT1460)
SKU:CSB-CF354400MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P64847
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAAPNDWDVVLRPHWTPLFAYAAAFLIAVAHVAGGLLLKVGSSGVVFQTADQVAMGALG LVLAGAVLLFARPRLRVGSAGLSVRNLLGDRIVGWSEVIGVSFPGGSRWARIDLADDEYI PVMAIQAVDKDRAVAAMDTVRSLLARYRPDLCAR
Protein Names:Recommended name: Uncharacterized protein Rv1417/MT1460
Gene Names:Ordered Locus Names:Rv1417, MT1460 ORF Names:MTCY21B4.35
Expression Region:1-154
Sequence Info:full length protein
