Gene Bio Systems
Recombinant Uncharacterized protein Rv1303-MT1343 (Rv1303, MT1343)
Recombinant Uncharacterized protein Rv1303-MT1343 (Rv1303, MT1343)
SKU:CSB-CF353795MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P64801
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTPAQDAPLVFPSVAFRPVRLFFINVGLAAVAMLVAGVFGHLTVGMFLGLGLLLGLLNA LLVRRSAESITAKEHPLKRSMALNSASRLAIITILGLIIAYIFRPAGLGVVFGLAFFQVL LVATTALPVLKKLRTATEEPVATYSSNGQTGGSEGRSASDD
Protein Names:Recommended name: Uncharacterized protein Rv1303/MT1343
Gene Names:Ordered Locus Names:Rv1303, MT1343 ORF Names:MTCY373.23
Expression Region:1-161
Sequence Info:full length protein
