Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv0476-MT0494.1 (Rv0476, MT0494.1)

Recombinant Uncharacterized protein Rv0476-MT0494.1 (Rv0476, MT0494.1)

SKU:CSB-CF353166MVZ

Regular price $1,969.80 CAD
Regular price Sale price $1,969.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64695

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALQRPDAYTAADKLTKPVWLVILGAAVALASILYPVLGVLGMAMSACASGVYLVDVRPKL LEIQGKSR

Protein Names:Recommended name: Uncharacterized protein Rv0476/MT0494.1

Gene Names:Ordered Locus Names:Rv0476, MT0494.1 ORF Names:MTCY20G9.02

Expression Region:20-87

Sequence Info:full length protein

View full details