Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein in hblA 3'region

Recombinant Uncharacterized protein in hblA 3'region

SKU:CSB-CF674911BQJ

Regular price $2,070.60 CAD
Regular price Sale price $2,070.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus

Uniprot NO.:Q45104

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VIPIETFAIEIQQTNTENRSLSANEEQMKKALQDAGLFVKAMNEYSYLLIHNPDVSFEGI TINGNTDLPSKIVQDQKNARAHAVTWNTHVKKQLLDTLTGIIEYDTKFENHYETLVEAIN TGNGDTLKKGITDLQG

Protein Names:Recommended name: Uncharacterized protein in hblA 3'region

Gene Names:

Expression Region:23-158

Sequence Info:full length protein

View full details