Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein ydzN(ydzN)

Recombinant Uncharacterized membrane protein ydzN(ydzN)

SKU:CSB-CF496096BRI

Regular price $1,748.75 CAD
Regular price Sale price $1,748.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis

Uniprot NO.:C0H3V7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA N

Protein Names:Recommended name: Uncharacterized membrane protein ydzN

Gene Names:Name:ydzN Ordered Locus Names:BSU05109

Expression Region:1-61

Sequence Info:full length protein

View full details